PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00135418001
Common NameGSBRNA2T00135418001, LOC106372003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 394aa    MW: 44313.8 Da    PI: 9.5232
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00135418001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.1e-32208261255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  GSBRNA2T00135418001 208 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 261
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15205261IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28206261IPR009057Homeodomain-like
TIGRFAMsTIGR015578.9E-24208261IPR006447Myb domain, plants
PfamPF002495.6E-7209260IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MEGVFLEKPK SNTTLPDLSL NISLPDITSK EHYRRPSQTD NNRSSNFELS LSHHHNPSSN  60
PTTRIIHSPD PRNLNLPHHQ HYNNPILNGG SLHQRVNGSD INSIHRPIRG IPVYQNRSFP  120
FHQQTSLPSL GGGGDLDQIS ILNSSSGYNN AYRSLQSSPR LRGVPLHHHH HNHYGVVGST  180
DSSSPHHHGM IRSRFLPKMP TKRSMRAPRM RWTSSLHARF VHAVELLGGH ERATPKSVLE  240
LMDVKDLTLA HVKSHLQMYR TVKTTNKPAA SSDGSGEEEM GINGNDVHHQ SSTDQRAQSD  300
DTSPHQEIDF PSTQPRWSNS SRETWPLSNN NYSSDIDTMI RTSSTSVISH HQRSILQNQE  360
QQRSSDQTKR CGDLSCNNPS LEFTLGRPDW HEK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00135418001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0301920.0AY030192.1 Arabidopsis thaliana clone A1-2 KANADI protein (KAN) mRNA, complete cds.
GenBankAY0486880.0AY048688.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI1 (KAN1) mRNA, complete cds.
GenBankBT0264360.0BT026436.1 Arabidopsis thaliana At5g16560 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013667580.10.0PREDICTED: transcription repressor KAN1-like
SwissprotQ93WJ90.0KAN1_ARATH; Transcription repressor KAN1
TrEMBLA0A078C3250.0A0A078C325_BRANA; BnaA10g17920D protein
STRINGAT5G16560.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66062645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.10.0G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]